41 results
9th grade phonics interactive notebooks
Trace, Color, Talk and Take Mini-Books BUNDLE -17 SOUNDS!
Looking for a quick and fun articulation or phonics activity that will get your students talking about words that start with their targeted letter or sound? If so, please consider adding this bundle to your download drawer. If you obtain this document, you will have immediate access to 32 quick print books that require NO PREP on your part. The letters included are: /B/, /P/, /G/, /K/, /D/, /T/, /F/, /H/, /S/, /SH/, /TH/, /V/, /Z/, /N/, /NG/, /R/, and /W/. The targeted sound groups include: s
Subjects:
Grades:
PreK - 9th
Closed and Open Syllables Introduction (PPT, Interactive Notebook, Worksheets)
This resources gives you everything you need for a lesson to introduce/review Open and Closed Syllables! It includes the following:PowerPoint PresentationReviews:Vowels vs. ConsonantsShort and Long VowelsSyllablesCounting SyllablesIntroduces:Closed SyllablesOpen SyllablesPractice Identifying features of Closed/Open SyllablesBlending Drill to practice reading Closed vs. Open SyllablesHas guided notes to follow alongInteractive NotebookClosed and Open notebook pages with doors that open and close
Subjects:
Grades:
1st - 12th
Rabbit + Monster Syllable Division Introduction (intermediate/secondary)
This lesson introduces the Rabbit and Monster syllable division patterns (VCCV + VCCCV). This resource has PowerPoint presentation, teacher script, and student packet to solidify students' understanding of this important, foundational skill for reading multi-syllabic words.This lesson was made with older Orton-Gillingham students in mind. It covers the basic, foundational OG skills but with more complex practice opportunities.What is included in the PowerPoint?:Syllable types review (Open, Clos
Subjects:
Grades:
4th - 12th
Structured Literacy Study Guide: The Ultimate Student Notebook
This resource contains a full Student Notebook including all syllable types and concepts which students are meant to use interactively during lessons. This notebook acts as a study guide or outline that works alongside structured literacy instruction. Although it is generally aligned with Wilson Reading System's scope and sequence, the notebook can be easily adapted with any structured language approach or used to guide a tailored intervention plan for any student. This student friendly noteb
Subjects:
Grades:
2nd - 12th
Phonics - Closed, Open & Closed Syllable Coloring Sheet!
Practice Activity for reviewing closed, open & closed exception syllables:
1. Complete the cloze rules for Closed, Open & Closed Syllable Exceptions
2. Color code the closed (red), open (blue) & closed syllable exceptions (purple) in the grid using the rules to expose the design. Any words that don't follow the rules can be left blank or colored a separate color.
4. Check answers with the included color-coded teacher's guide/answer key
Notes:
1. All 'words' included are nonse
Subjects:
Grades:
3rd - 12th
REALIDADES 2. 1A. LISTENING COMPREHENSION. STEM-CHANGING VERBS.
STUDENTS WILL LISTEN TO A SHORT ORAL DESCRIPTION IN SPANISH DONE BY THE TEACHER (THIS IS INCLUDED IN THE LAST SLIDE, PRINT IT TO BE ABLE TO READ IT TO THE CLAS) AND WILL MATCH THE DESCRIPTION WITH A PICTURE. ANSWERS ARE INCLUDED. SET OF INSTRUCTIONS INCLUDED ON THE FIRST SLIDE.
Grades:
3rd - 12th
STOPS: Trace, Color, Talk and Take Mini-Books: /B/, /P/, /G/, /K/, /D/, & /T/
Looking for a quick and fun articulation or phonics activity that will get your students talking about words that start with their targeted sound in the stop consonants sound group? If so, you may want to give these new mini books that we have created a try next time in your therapy room or classroom!
We have provided one Trace, Talk & Take Book and two Color, Talk and Take book for each stop consonant sound. The students have fun coloring and tracing and discussing their speech sounds and
Subjects:
Grades:
PreK - 9th
Also included in:Â Trace, Color, Talk and Take Mini-Books BUNDLE -17 SOUNDS!
Cat Kite Rule Advanced Orton Gillingham
Cat/Kite Rule part 2! When teaching the Cat/Kite rule did you ever start to wonder about 'the other letters?' Well, this helps explain that. K only gets E, I, Y and the end of words, while C goes with everything else.This Cat/Kite pack is for older/advanced students. Chant shows how C goes with a, o, u and consonants AND how it comes at the end of multisyllabic words like magic, epic, and fantastic.1. Four poster options to use.2. Mystery word solve and create.3. Student mini graphics for inte
Grades:
2nd - 12th
Alphabet HandWriting Practice - Letters Nn to Zz (Print/Manuscript)
A complete alphabet handwriting practice (letters Aa to Mm) for pre-k to 6th Grade in box, print and manuscript (D'Nealian).
What you will find:
* Letters Nn to Zz Handwriting practice
* 13 page workbook per alphabet.
* Path of Motion page
* Handwriting practice pages (box, print and D'Nealian/Manuscript)
* 6 picture words
See the Letters Aa to Nn Handwriting practice (Print/Manuscript) HERE.
*** Download the Letter A for FREE until 4/30/2015 HERE
*** GET THE Letters Aa to Mm PRINT &
Subjects:
Grades:
PreK - 12th
Nasals, Glides, Liquids: Trace, Talk & Take Mini-Books (NO PREP)
Looking for a quick and fun articulation or phonics activity that will get your students talking about words that start with their targeted sound in the nasals, glides and liquids sound groups? If so, you may want to give these new mini- books that we have created a try next time in your therapy room or classroom!We have provided one Trace, Talk & Take Book and two Color, Talk and Take books for each nasal, glide and liquid. The students have fun coloring and tracing and discussing their sp
Subjects:
Grades:
PreK - 9th
Also included in:Â Trace, Color, Talk and Take Mini-Books BUNDLE -17 SOUNDS!
Phonics in the Middle (Consonant -le Supplemental Resources), supp. w/ SPIRE
This product can be used to supplement any phonics intervention program. I currently use this product as an added resource with the S.P.I.R.E. reading/phonics intervention program. I am witnessing significant, noticeable gains in my students' progress toward their phonics I.E.P. goals/objectives!Many many phonics programs and curriculums cater to younger struggling learners. The resources (including the "practice" words) did not present the challenge my middle school students needed. My students
Subjects:
Grades:
5th - 12th
Digital Morphology, Etymology, and Phonics Book
Hello! This is a digital notebook containing 3rd-6th grade latin root words and greek combining forms, as well as prefixes and suffixes. There are spots to add more and you can move the sticky notes around if you need to add more to your class--this is meant to be an introduction to the study of words. It will download as a powerpoint file.
Subjects:
Grades:
3rd - 12th
Alphabet HandWriting Practice - Letters Aa to Mm (Print/Manuscript)
A complete alphabet handwriting practice (letters Aa to Mm) for pre-k to 6th Grade in box, print and manuscript (D'Nealian).
What you will find:
* Letters Aa to Mm Handwriting practice
* 13 page workbook per alphabet.
* Path of Motion page
* Handwriting practice pages (box, print and D'Nealian/Manuscript)
* 6 picture words
See the Letters Aa to Nn Handwriting practice (Print/Manuscript) HERE.
*** Download the Letter A for FREE until 4/30/2015 HERE
*** GET THE Letters Aa to Mm HERE CURSI
Subjects:
Grades:
PreK - 12th
Phonics - Closed/Open Syllable Sorting Activity
Practice Activity for reviewing closed and open syllables:
1. Color-code a short list of closed (red) & open syllables (blue) using the 'reminder' hints for closed and open syllables based on the rules
2. Mark the syllables by scooping to the end of the syllable, marking it c for closed or o for open and marking the vowel short (with a breve) or long (with a macron)
3. Cut and glue the syllables into the graphic organizer to sort by closed or open
4. Check answers with the included col
Subjects:
Grades:
3rd - 12th
First: Trace, Then: Match: Letters A-Z interactive book
*** This product will only be FREE for the first 24 hours, so if you are able to download it for FREE, please make sure to leave me a review. Thank you! (: ****
This book will help your students with letter identification and also with writing their letters. This book requires students to first write the letter by tracing it, then they will have to match the letter by finding the letter in a field of 12 (you can lessen the field by taking the velcro numbers off).
***I printed my sample book o
Subjects:
Grades:
PreK - 12th
ABC Bootcamp - Capital Letter Outlines for A-Z & ABC Bootcamp - Capital & Lower
Capital Letter Outlines for A-Z & ABC Bootcamp - Capital Letter Outlines for A-Z
Subjects:
Grades:
PreK - 12th
Bitmoji Classroom Bundle for Distance Learning
This set of 5 super cute, and super trendy slides have made my online teaching experience so much smoother. It has increased my students’ engagement online as well as their self-regulation.Each slide features a different classroom setup, different styles, and different designs!Included are over 50 original images, drawn by me, that I hope will help other fellow educators customize their online teaching and learning experience to their needs and student needs.I use these 5 slides for each day of
Subjects:
Grades:
K - 12th
Articulation Warm-Up Book
This product is a useful tool that helps establish therapy routine by providing students a daily articulation warm-up.
Each page challenges students to say their target sound in the initial, medial, and final position of words. Each illustrated word is accompanied by five squares, designed to be checked each time the student says their target word. Boxes can be checked over and over again when placed in clear protective sheets and marked with dry-erase markers. This product can be used in
Subjects:
Grades:
PreK - 12th
Phonics Wall: Red and Blue Subheading Sections
This product is great for a phonics wall, word wall, anchor chart, small group, whole group and stations.This Product Has:Hard "G" SoundSoft "G" SoundHard "C" SoundSoft "C" Soundblclchckdrfrflplphprghgrglslscsksmsnspstswthtrtwwhwrqu"NTCH" Trigraphs"SCH" Trigraphs "SCR" Trigraphs"SHR" Trigraphs"SPL" Trigraphs"SPR" Trigraphs"SQU" Trigraphs"STR" Trigraphs "THR" TrigraphsAU Diagraphs AI Digraphs AW DiagraphsAY Diagraphs EA DiagraphsEI Diagraphs EE DiagraphsEU Diagraphs EW DiagraphsEY DiagraphsOY Dia
Grades:
PreK - 12th
Funky Bitmoji Classroom for Distance Learning
Part of my bundle that includes all 5 super cute slides! I created these images to add a little more of my style to my virtual classroom, and then I customized each image to link to what works for me and what works for my students!I use 5 different slides for each day of the week and assign independent tasks or mini lessons by linking to one of the many images, however using a slide for each day is my personal preference. If you’re looking for a single cute, customizeable, and affordable option,
Subjects:
Grades:
K - 12th
Prefix Journal: First Set of 11 (Works well with Canvas/virtual students)
This is a Prefix Journal that has a slide for 11 different prefixes. The student looks up the meaning from the first two slides that lists all of them. They then brainstorm (or look-up) at least 5 words that uses that prefix. Then they choose one of those words and find a picture to represent that word. They do this for each prefix. It is meant to help students memorize morphemes and have an interactive/virtual journal of them to review.
Subjects:
Grades:
3rd - 9th
Also included in:Â Reading Intervention: Interactive Journals Bundle - Decoding/Spelling
Latin Roots Journal: First Set of 12 (Works well with Canvas/virtual students)
This is a Latin Roots Journal that has a slide for 12 different common Latin roots. The student looks up the meaning from the first two slides that lists all of them. They then brainstorm (or look-up) at least 3 words that uses that Latin root. Then they choose one of those words and find a picture to represent that word. They do this for each Latin root. It is meant to help students memorize morphemes and have an interactive/virtual journal of them to review.
Subjects:
Grades:
1st - 12th
Also included in:Â Reading Intervention: Interactive Journals Bundle - Decoding/Spelling
Quick Virtual Phonics Activities (s, t, m, r)
This quick virtual phonics activity is good for almost any age. It is a great way to differentiate phonics instruction, or for you to reach students who would typically not be able to due to scheduling.
Grades:
PreK - 12th
Showing 1-24 of 41 results
Find Phonics resources | TPT
Learn more about phonics resources
You’ve probably heard that phonics is essential for students who are learning to read (and it is!), but you might be asking yourself: “What is it, exactly?” Phonics is a method for teaching children how to read and write in an alphabetic language. The goal is to help kids connect phonemes (the sounds in words) and graphemes (the symbols used to represent them). Ultimately, once students understand which sounds in spoken language correspond to which symbols (e.g., letters in the alphabet), they’ll be well on their way to learning how to read books and other written materials.
If you’re a teacher or parent looking for printable and digital resources to help your student learn phonics, but you’re not sure where to start, TPT has got you covered. We have a comprehensive collection of phonics resources, created by other teachers, that are designed to help with any learning need. With plenty of TPT resources at your fingertips, you can teach phonics to your students in no time at all.
Phonics resources to try
You can teach phonics and engage your students at the same time, with a variety of activities that cater to different learning styles and preferences. Here are a few examples of the different types of resources that you can find on TPT to help teach students about the relationships between letters and sounds.
Alphabet Scavenger Hunt
Hide letter cards around the room, say a sound aloud, and then have students search for the card that represents the sound.
Phonics Hopscotch
Take learning out onto the playground or at home with this easy-to-organize activity to help students build sound and letter recognition. Draw a hopscotch grid with letters in each square. Students jump on the letters while saying the corresponding sounds.
Silly Sentences
Have students create silly sentences using words that start with the same sound. An example could be: “Sally sells seashells by the shore.”
Anchor Charts
Post anchor charts around the room to help kids remember important rules or sounds being taught. (It could cover phonics concepts like the silent “e,” the long “o,” or a particular diphthong.)
Guess the Missing Letter or Sound
Use task cards or write a set of words on the board that share either a letter or sound. For example, at, ug, __ig. Ask students to find the missing letter or sound. Fill it in to show them the words bat, bug, and big.
These (and other!) activities can make learning phonics enjoyable and memorable for every student. Remember to adjust the activities based on the age and skill level of your students.
Frequently asked questions about teaching phonics
What types of phonics resources are available on TPT?
There are many different types of phonics resources sold by Sellers on TPT — from worksheets to interactive notebooks to units. Resources like these make great activities for students to practice their phonics skills.
How do I find phonics resources on TPT?
Educators can save time preparing phonics lessons with resources created by experienced teachers. Simply start a search for phonics resources on the TPT marketplace, and filter by grade level, price, and/or resource type to find materials that've been proven to work in classrooms like yours. No matter what you’re teaching, there are plenty of phonics lessons and activities sold by Sellers on TPT that are tailored to meet your students' skill levels.
TPT is the largest marketplace for PreK-12 resources, powered by a community of educators.
IXL family of brands