141 results
Religion word walls for staff and administrators $5-10
The Christmas Story {Nativity Activities and Printables}
In this pack children learn all about the Nativity as told in the Bible. Full of engaging activities and printables, this resource encourages children to know and respond to the Christmas story in meaningful ways.This resource is suitable for use in your classroom, Sunday School or home, with the activities and worksheets able to be used as individual, whole class or small group tasks. A suggested teaching sequence is included, however you can use the pages in whatever order you prefer.What's
Subjects:
Grades:
K - 1st
Types:
Bible Vocabulary: 100 Terms to Know
This resource includes 100 need-to-know Bible terms that will help your students comprehend important Bible vocabulary. This print-and-go resource includes 100 Bible Vocabulary cards (in both color and black and white) and a student dictionary booklet. Perfect for busy Christian school teachers, Sunday school leaders, or homeschooling parents. I am passionate about getting elementary students in their Bibles and want them to be able to understand what they’re reading. A lot of times they need t
Subjects:
Grades:
3rd - 6th
Also included in: Bible Classroom Decor Bundle
Ancient Israel Vocabulary Activity Set and Word Wall Bundle
This Ancient Israel Vocabulary bundle contains our Ancient Israel and Judaism Vocabulary Activities for Google Drive and our Ancient Israel Word Wall. The words used in each resource are the same and go great together!This Ancient Israel and Judaism Word Wall contains 24 words and is available in both a color version and a (mostly) black and white version. These easy-to-read cards are ready to print and display in your classroom! All cards include the word itself, the definition, and a historica
Subjects:
Grades:
6th - 9th
Types:
Virtue Display Cards | for Catholic Schools | Religion Posters
Elevate the values and virtues within your Catholic School with the Virtue Display Cards. This comprehensive set includes 33 beautifully designed virtue cards and 2 mounting sheets, specially designed to inspire and engage your students, staff, and school community.This resource includes: 33 Virtue Cardsrespectthankfulnessjusticepatiencewisdomresponsibilitycompassionforgivenessstewardshiptolerancehonestyempathyintegrityreverenceacceptancehopetruthfamilyservicehospitalityservicepeace-makingcharit
Subjects:
Grades:
Not Grade Specific
The Seven Sacraments - Classroom Poster Set
Full-color Poster Set - Perfect for the classroom, library or even the staff room. Posters Included:BaptismConfirmationEucharistPenanceMarriageAnointing of the SickHoly OrdersSize: 8.5 x 11
Subjects:
Grades:
1st - 12th, Higher Education, Adult Education, Staff
Sunday school decor, bible verse posters bundle, set of 10. Happy retro colors
Printable bible verses posters bundle featuring fun quotes in fun retro color letters. Great for Sunday school, Catholic and Christian school classroom decoration. Simple bible quotes wall art designs. Also ideal for kids room and Christian themed playroom wall art decor.You will get 10 printable posters.INCLUDEDPoster size:- 16 x 20 inch. You can also use this file for printing on 8x10 inch and 4x5 inch paper sizes (set "fit to page" when printing).Forma
Subjects:
Grades:
Not Grade Specific
Christian school posters bundle, set of 15. Printable bible verses for decor
Printable bible verses posters bundle featuring fun quotes in fun bright color letters. Great for Sunday school, Catholic and Christian school classroom decoration. Simple bible quotes wall art designs. Also ideal for kids room and Christian themed playroom wall art decor.You will get 15 printable posters.INCLUDEDPoster size:- 16 x 20 inch. You can also use this file for printing on 8x10 inch and 4x5 inch paper sizes (set "fit to page" when printing).Format file:
Subjects:
Grades:
Not Grade Specific
Latin Vocabulary Posters & Activities {Prima Latina Lessons 1-20}
In this BUNDLE are Latin vocabulary posters that follow along with the instructional guide, Prima Latina: An Intro to Christian Latin, to teach Classical Latin to elementary students. This pack has more than 75 colorful vocabulary posters with real-life photos to help students connect to the vocabulary. Posters come as two to a page for easy printing and cutting. They can be posted on a bulletin board to introduce each lesson or use them to build a word wall for the entire year. There are also a
Subjects:
Grades:
2nd - 4th
Types:
Classical Conversations Cycle 3 End-of-Year Certificates
Directors, this one is for you! All your Classical Conversations Cycle 3 end-of-year certificates are in one place. In this download, you will find 8.5x11" PDFs for the following accomplishments:Student Foundations Completion of Cycle 3Essentials Completion of Tour 1 in Cycle 3Essentials Completion of Tour 2 in Cycle 3Essentials Completion of Tour 3 in Cycle 3Foundations Mini Memory MasterFoundations Memory MasterTeacher (Parent) Foundations Completion of Cycle 3"Accepting the Challenge" for stu
Subjects:
Grades:
Homeschool
Buddhism | Self - Personal Identity (POSTER | FLASHCARD)
This set of Printable Posters / Flashcards includes:✓ Clear + Organized + Stylized Content✓ FREE RESOURCES LINKED BELOW✓ ANIMATED VERSIONTopic & Details: EASTERN PHILOSOPHY - BuddhismRelated Content:Teaching Religion (FREE POSTER)Studying Religion (PPT)Philosophy of Religion (COMPLETE - PPT Bundle)World Religions (COMPLETE - PPT Bundle)Rebeka Ferreira's Content:✓ Like & Subscribe on YouTube✓ Follow Rebeka on Pinterest✓ FREE Educational Resources
Grades:
Not Grade Specific
Also included in: INTRO | Buddhism (Printables Bundle)
Bible memory verses posters bundle. Catholic and Christian classroom decor
Printable bible verses posters bundle featuring fun quotes in fun retro color letters. Great for Sunday school, Catholic and Christian school classroom decoration. Simple bible quotes wall art designs. Also ideal for kids room and Christian themed playroom wall art decor.You will get 10 printable posters.INCLUDEDPoster size:- 16 x 20 inch. You can also use this file for printing on 8x10 inch and 4x5 inch paper sizes (set "fit to page" when printing).F
Subjects:
Grades:
Not Grade Specific
100 Names of Jesus Paper Chain – Bible Verses – Christian
Paper chain with 100 links. Each link has a large number (1-100), a name or description of Jesus, and a Relevant Bible verse. Great for Back to School or 100th Day – Begin first day of school and count to 100th!Quick and easy way to focus on Jesus each day. Read and discuss the paper link, then add it to the growing paper chain. Kids love watching the chain grow as they celebrate all the ways that Jesus loves them. Includes both color and black and white version. Check out the preview to see ex
Subjects:
Grades:
Not Grade Specific
Catholic Schools Week - Bible Stories Theme
God speaks to us through the Bible, other people, and things that happen.
We will be reading a Bible story each day on morning announcements!
This pack is for Catholic Schools Week and is the Bible Stories Theme. It includes EVERYTHING you need for the entire week for the entire school!!! This pack includes:
pg.1-title page
pg.2-printable Catholic Schools Week itinerary from Sunday through Friday that can be copied and sent home to families, to the faculty members, or even put in your church b
Grades:
Not Grade Specific
Sunday school Church Decor. Bible verses posters bundle Vol. 78. Neutral colors
Printable religious bible verses posters bundle featuring brown neutral colors design. Great scripture quotes for Sunday school, Catholic and Christian school classroom decoration. Simple modern bible quotes wall art designs. Also fun for nursery, kids room and Christian themed playroom wall art decor.You will receive 4 posters.INCLUDEDPoster size (each poster comes in this size):- 16 x 20 inch. You can also use this file for printing on 8x10 in
Subjects:
Grades:
Not Grade Specific
Types:
Fruit of The Holy Spirit Coloring Pages. Editable craft activity for banners
Welcome to our Fruit of The Holy Spirit Coloring pages for craft activity! This editable PowerPoint is perfect for Sunday school teachers, Christian school teachers, and parents looking for engaging activities for kids to learn more about the message from Galatians 5:22-23.- Text is editable in PowerPoint, so you can change and edit as needed- Engaging craft activity for kids to learn more about Galatians 5:22-23- Ready to print and easy to color- Super cute fruit themed designs- Perfect for kin
Subjects:
Grades:
K - 2nd
Types:
Stewardship Resources for Church or School
Catholic school or parish leaders assisting in the stewardship education of students will find this packet full of great ideas. Commitment brochures are editable and there are tips for guiding witness speakers. Lists of parables and sayings applicable to stewardship education are also included.
Subjects:
Grades:
Not Grade Specific
Bible memory verse coloring pages for VBS Summer Sunday School Activity for kids
Welcome to our collection of Printable Bible Verse Coloring Pages for Summer Vacation Bible School Activity! These coloring pages are perfect for Sunday school teachers and Christian parents looking for a creative and educational activity for their kids during the summer break.Our Bible verse coloring pages are designed specifically for VBS Sunday School activities, providing children with a fun and engaging way to learn about important teachings from the Bible. - Fun summer design with inspirat
Subjects:
Grades:
1st - 3rd
Types:
Bible coloring pages for teens. Set of 12. Sunday school memory verse activity
New printable positivity Bible coloring pages for teens is here! These pages are perfect for teachers and parents looking for a fun and creative way to engage teens with the stories and teachings of the Bible.- Modern design: Our coloring pages feature contemporary designs that appeal to teens and make the Bible come to life in a fresh and exciting way.- Fun for teens: Coloring is a relaxing and enjoyable activity that teens can do alone or with friends, making it a great way to encourage them t
Subjects:
Grades:
7th - 9th
Types:
Teacher Bible Study Devotion: Be Still (The Book of James)
Friend,During this time of social distancing, virtual teaching, and distance learning, life can feel so uncertain! I hope this devotion brings you some peace in the midst of the chaos and fear! Know I am praying for you and your family!!!Thank you so much for your consideration of this Bible study through the book of James! I recently realized that the element I had been missing from my personal devotion time was BEING STILL…I was scurrying through my quiet time the same way I was scurrying t
Grades:
Staff
The Lord's Prayer poster. Our Father who art in heaven. Bible verse, Boho
Printable Christian bible verse scripture poster featuring quote The Lord's Prayer "Our Father who art in heaven, hallowed be thy name, thy kingdom come,... ".Christian sayings wall art in lovely boho colors. Simple modern design.Fun wall art to decorate kids room, Sunday school, Catholic and Christian school wall, and also for Church Bulletin Board decoration. I
Subjects:
Grades:
Not Grade Specific
Psalm 23 poster. The Lord is my shepherd. Christian and Catholic classroom decor
Printable Christian sayings poster in fun bright colors. Bible verse wall decor art featuring religious quote from the bible. Psalm 23, The Lord is my shepherd, I shall not want...Modern style wall art featuring bright colors stripes design. Great for Church Sunday school and Christian classroom decoration.This wall art is also fun to decorate kids playroom or bedroom. INCLUDED1 printable posterFormat file: High resolution JPEG, 300 dpi (file is zipped)Wall art SIZE:16 x 20 inch. You can also us
Subjects:
Grades:
Not Grade Specific
Also included in: Bible verses posters bundle vol. 101. Rainbow colors
Our Father, The Lord's prayer poster. Bible verse wall art decor
Step up your classroom or home decor with our bright and colorful printable bible verse wall art! If you're looking to add a touch of faith and inspiration to your space, look no further. Our digital download features modern designs and easy-to-read religious quotes in fun bright rainbow colors.This set features verse: The Lord's prayer, "Our Father..." Don't wait, add a pop of faith to your classroom or home today with our printable bible verse wall art. Get it now!Form
Subjects:
Grades:
Not Grade Specific
Also included in: Bible memory quotes posters bundle Vol. 100. Sunday school wall decor
Bible verse posters bundle - Sunday school classroom decor
Bible verse posters bundle featuring colorful typography design with inspirational words from bible quotes. Perfect for Sunday school classroom décor and church wall art. This printable set is also fun for kids bedroom decoration.Get this bundle, and you'll save more! The bundle includes 4 posters with the following Christian sayings:1. Be kind to one another - Ephesians 4:322. With God all things are possible, Matthew 19:263. He counts the stars and call them all by name - Psalm 147:44. I am a
Subjects:
Grades:
PreK - 6th
Types:
Magazine Cover Birthday Card, Appreciation Card for Teachers, Gifts for Students
Celebrate birthdays with a personal touch using this magazine-style card! You can easily customize them on Canva with different-size templates. Use them for multiple birthdays and occasions for students, teachers, and staff members! **No printed materials will be shipped!✅INSTANT ACCESS✅NO EXPIRATION DATE - USE YOUR DOWNLOAD FOR MULTIPLE OCCASIONS IN THE FUTURE✅PRINT AT HOME OR PROFESSIONALLY--------------------------YOU WILL RECEIVE--------------------------Editable Template - (All edits can on
Subjects:
Grades:
Not Grade Specific
Showing 1-24 of 141 results
TPT is the largest marketplace for PreK-12 resources, powered by a community of educators.
IXL family of brands