TPT
Total:
$0.00

Subjects

Arts & Music
English Language Arts
Foreign Language
Holidays/Seasonal
Math
Science
Social Studies - History
Specialty
For All Subject Areas
12,633 results

Martin Luther King Day reading flash cards for homeschool

Preview of Sight Words Practice with Decodable Sentences Cards with Assessments BUNDLE

Sight Words Practice with Decodable Sentences Cards with Assessments BUNDLE

You understand the importance of sight words and decoding practice! These high frequency word flashcards help children read sight words in isolation and in decodable sentences! Every card helps readers improve their word recognition, fluency, and decoding skills! They are perfect for guided reading, reading lessons, and homework. Click on the preview to see what makes these cards so special!Reading research supports learning new sight words within a sentence. What is included?400 sight word card
Preview of ABC Big Flashcards w/ Movements

ABC Big Flashcards w/ Movements

Created by
Lisaelaine
ABC Big Flashcards with optional backside with letter, movement explanation, and keyword. A-Z, short and long vowel sounds, both sounds for c,g,s,x and all 4 sounds of y included. **Letters on top!A-apple,apronB-board, ball (2 options)C-cat, circle (both sounds of c)D-dogE-edge, eagleF-front teeth, fish (2 options)G-guitar, giraffe (both sounds of g)H- heartI- igloo, iceJ- jacketK- keyL- lionM- monkey, meal (2 options)N-noseO-octopus, openP- pig, push (2 options)Q-queenR- rainbowS- snake, dogs (
Preview of Phonics Decoding Drills Sheets Practice Worksheets One Syllable Words 1st Grade

Phonics Decoding Drills Sheets Practice Worksheets One Syllable Words 1st Grade

Decoding Drills are here! After learning a new phonics skill, students need to apply that skill in word reading. Decoding Drills provide students the opportunity to practice their newly learned skills in a fun and engaging format.The use of nonsense words in Decoding Drills helps students build speed and automaticity when reading. The use of real words in Decoding Drills provides students exposure to words with that skill. This means that this practice will improve student fluency when reading.
Preview of Digraph Big Flashcards w Movements

Digraph Big Flashcards w Movements

Created by
Lisaelaine
Digraph Big Flashcards with backside that includes digraph, sound(s), movement explanation, and keyword. **Letters on top!Included:ckshch (2 picture options for /ch/) Card for just /ch/ and card for /ch/, /sh/ and /k/th- voiced and unvoicedwhphngqu
Preview of Pre-Primer Dolch Sight Word Flash Cards with picture cues

Pre-Primer Dolch Sight Word Flash Cards with picture cues

Created by
Lisa Lynn Riddle
High Frequency Word CardsLearning high frequency words can be very difficult for students with dyslexia or who are struggling readers. As a first grade reading teacher, it is especially frustrating to watch a student work day after day on the same high frequency words with little or no success. Research has shown that many students who do have these difficulties think and remember visually with pictures. I incorporated pictures into those words to give my students an image to remember with the w
Preview of Decoding Sight Words "Interactive" Phonics Practice (w/audio) | Secret Stories

Decoding Sight Words "Interactive" Phonics Practice (w/audio) | Secret Stories

Created by
Secret Stories
Teach the READER, not the reading with Secret Stories® Decoding Sight Words "Interactive" Phonics Practice (w/audio)! The Secret Stories® embedded mnemonic sound images bring phonics sounds to life, making even the trickiest "so-called" sight words easily decodable! (Watch a video preview of this product here.)Did you know that for experienced readers, virtually EVERY word is a sight word? That’s because the definition of a sight word is ANY word that is recognized by sight, meaning that it has
Preview of Bundle- High Frequency Dolch Sight Words- Preprimer, Primer,1st, 2nd, 3rd Grade

Bundle- High Frequency Dolch Sight Words- Preprimer, Primer,1st, 2nd, 3rd Grade

Created by
Lisa Lynn Riddle
Bundled Dolch Sight Word SetsPre-primer, primer, 1st Grade and 2nd GradeHigh Frequency Dolch Sight Word CardsLearning high frequency words can be very difficult for students with dyslexia or who are struggling readers. As a first grade reading teacher, it is especially frustrating to watch a student work day after day on the same high frequency words with little or no success. Research has shown that many students who do have these difficulties think and remember visually with pictures. I incorp
Preview of Two Letter Consonant Blends BIG Flashcards

Two Letter Consonant Blends BIG Flashcards

Created by
Lisaelaine
Two Letter Consonant Blends BIG Flashcards-22 Blends Flashcards Front: letters and keyword pictureBack: letters, sound, movement explanation, and keywordBlends included:blclflglplslbrcrdrfrgrprtrscskslsmsnspstswtw
Preview of Sight Word Practice with Decodable Sentences | High Frequency Words Set 1

Sight Word Practice with Decodable Sentences | High Frequency Words Set 1

You understand the importance of sight word practice! These sight word flashcards help children read high frequency words in isolation and in decodable sentences! Every card helps readers improve their word recognition, fluency, and decoding skills! They are perfect for guided reading, reading lessons, and homework. Click on the preview to see what makes these cards so special!Reading research supports new learning sight words within a sentence. What is included?250 sight word cards with decodab
Preview of Letter Cards | Letter Sound Review | High Frequency Words | Structured Literacy

Letter Cards | Letter Sound Review | High Frequency Words | Structured Literacy

Research shows that consistent review of previously taught skills and concepts is one of the BEST ways to ensure kids master foundational literacy skills. This resource includes EVERYTHING you need to implement an engaging, quick and effective review routine. These letter cards, high-frequency word cards, assessments and progress monitoring sheets are a perfect addition to your whole group, small group, or online learning instruction. This Resource Includes: Over 190 Printable Phoneme-Grapheme C
Preview of Secret Stories® Phonics Mystery Words w/Embedded Mnemonic Alphabet Cards

Secret Stories® Phonics Mystery Words w/Embedded Mnemonic Alphabet Cards

Created by
Secret Stories
***This product is intended for use WITH the Secret Stories® Flashcards***Excite your students and get their brains warmed up each morning with a Secret Stories® "mystery word" of the day! Students can try to crack the code to decode the word each morning. While this product can be used on its own to spell out CVC words, it is intended for use with the Secret Stories® 6x6 Flashcards (SOLD SEPARATELY) to build ANY word! For more ideas, search for "mystery words" in the Secret Facebook Group and d
Preview of Greek and Latin Roots, Root Words, Prefixes, Suffixes, Affixes Units 1-10

Greek and Latin Roots, Root Words, Prefixes, Suffixes, Affixes Units 1-10

Created by
Rockin Resources
Are your students struggling with vocabulary? Look no further! Greek and Latin roots, words, and affixes are the “building blocks” of the English language. In these units, students will learn prefixes, suffixes, and root words that will help them with word meanings and spelling conventions. They will learn how to break down larger words in their reading! It is a win-win because they will be decoding words in all subject areas, and their reading comprehension will improve tremendously. To add to
Preview of CVC Rhyming Words Flashcards - Taskcards - Science of Reading RTI Phonics

CVC Rhyming Words Flashcards - Taskcards - Science of Reading RTI Phonics

Created by
Babbling Abby
WHAT'S INCLUDEDThis is a set of CVC RHYMING FLASHCARDS for you to use as a resource for instruction or reference tool for your students in preschool, kindergarten, first grade, and second grade. This set is also a part of money-saving BUNDLES Kindergarten in a Flash: ELA Edition & First Grade in a Flash: ELA Edition(please do not purchase if you own either). 115 RHYMING FLASHCARDS (color + black and white):This set includes CVC rhyming words. Each card includes the picture and word.SUGGESTIO
Preview of EDITABLE | HEART WORDS | SIGHT WORDS | Science of Reading

EDITABLE | HEART WORDS | SIGHT WORDS | Science of Reading

Are you looking for eye-catching high frequency ❤️ HEART WORD ❤️ cards for your sound/word wall that align with the Science of Reading?Then, this EDITABLE sight word resource is for you!The Science of Reading has brought about a change in the way educators approach high-frequency word instruction. It is now recognized that high-frequency words can be split into two categories: decodable (“Flash Words”) and irregular (“Heart Words”).Decodable Flash Words are expected to be read and spelled automa
Preview of Decoding Drills for Fluency - Short Vowel Edition - Science of Reading Aligned

Decoding Drills for Fluency - Short Vowel Edition - Science of Reading Aligned

Decoding Drills for Fluency Check out the BUNDLE for a discount on ALL Decoding Drills resources!Short Vowel Decoding Drills are here! After learning a new phonics skill, students need to apply that skill in word reading. ---------------------------------------------------------------------------------------------------------------------------- --DISTANCE LEARNING UPDATE - August 17, 2020--- ***I have now added DIGITAL versions of these Short Vowel Decoding Drills that have been formatted for us
Preview of CVC BLENDING FLASH CARDS- Teach Reading

CVC BLENDING FLASH CARDS- Teach Reading

Created by
Jady Alvarez
These are 52 flash cards word in the front, picture in the back. Three letter words CVC- Consonant Vowel Consonant. The pack brings the most 8 common word families represented in the set. The word families in this set are: at, an, am, ag, ap, et, ug, ot, ig. All five vowels are included. The vowels are in red so that the child can focus on elongating the vowels in red to make blending easier! This is an excellent way to practice blending with preschool, kindergarten and 1st grade students! You
Preview of Phonics Posters Cards BUNDLE - Blends, Digraphs, Vowels, Diphthongs & more!

Phonics Posters Cards BUNDLE - Blends, Digraphs, Vowels, Diphthongs & more!

Created by
Fairy Poppins
This Phonics Posters Bundle features beginning blends, ending blends, triple blends, beginning digraphs, ending digraphs, trigraphs, short vowels, long vowels, diphthongs, r controlled vowels and more!What I love about these posters!There are four designs to choose from (all newly updated) - plain borders, primary colors borders, bright borders or boho bordersThey are comprehensiveThere are cover pages included to keep your posters organizedSet 1 - Phonic Posters (Beginning Blends, Ending Blends
Preview of Eyewords Sight Words Teaching Cards Bundle, Words 1-150 (Digital Download)

Eyewords Sight Words Teaching Cards Bundle, Words 1-150 (Digital Download)

Created by
Eyewords
Eyewords™ Multisensory Sight Word Teaching Cards have been created to differentiate reading instruction for young and/or struggling readers. In combination with phonemic instruction, Eyewords™ provides a multisensory - visual, auditory and kinesthetic approach to teaching the high frequency words.Eyewords™ Multisensory Sight Words Bundle, Sets 1-3 include the first 150 high frequency words. Pages are arranged for double-sided printing. Words with contextual-embedded pictures are displayed on the
Preview of Phonics Card Games for Decoding Nonsense Words Bundle for Nonsense Word Fluency

Phonics Card Games for Decoding Nonsense Words Bundle for Nonsense Word Fluency

Created by
Tammys Toolbox
These crazy phonics card games use the science of reading to help kids who need extra practice with nonsense word decoding strategies and syllable division rules. In Crazy Words, players must read single-syllable nonsense words to get rid of their cards. And in Crazy Nonsense Words 2 - Multisyllable Edition, players must use decoding skills to read multisyllable nonsense words correctly. Both games are great for providing practice with syllable division rules, syllable types, and decoding skills
Preview of R Controlled Vowels Big Flashcards w Movements

R Controlled Vowels Big Flashcards w Movements

Created by
Lisaelaine
R Controlled Vowels Big Flashcards with backside that includes r-controlled vowel, sound, movement explanation, and keyword.**Letters on top!Includes:er, ur, ir aror
Preview of Orton Gillingham Scope and Sequence, Phoneme Card Deck & Editable Lesson plan

Orton Gillingham Scope and Sequence, Phoneme Card Deck & Editable Lesson plan

This Orton Gillingham bundle includes an Orton Gillingham scope and sequence, an editable Orton Gillingham lesson plan & a printable phoneme card deck. This bundle is the MUST-HAVE for any Orton Gillingham tutor!The phonics card deck includes:every single phoneme taught in the Orton Gillingham scope and sequence5 common prefixesthe most common 28 suffixes!!! Card Deck Layout:The front of the card shows the grapheme (letter) and the back shows order of frequency, alternate spellings, and wo
Preview of Phoneme Deletion and Substitution Flashcards - Taskcards - Science of Reading

Phoneme Deletion and Substitution Flashcards - Taskcards - Science of Reading

Created by
Babbling Abby
WHAT'S INCLUDEDThis is a set of PHONEME DELETION AND SUBSTITUTION FLASHCARDS/TASKCARDS for you to use as a resource for instruction or reference tool for your students in preschool, kindergarten, first grade, and second grade. This set is also a part of money-saving BUNDLES Kindergarten in a Flash: ELA Edition & First Grade in a Flash: ELA Edition(please do not purchase if you own either). 79 PHONEME DELETION AND SUBSTITUTION FLASHCARDS (color + black and white):This set includes flashcards/
Preview of Reading Comprehension {Pre-Primer Sight Words}

Reading Comprehension {Pre-Primer Sight Words}

Reading comprehension is fun when you use "Fold and Focus" reading passages!Help your emergent readers feel confident and successful! I created this engaging activity for my struggling readers. These passages contain ONLY Pre-Primer sight words and CVC words. Fold the printable so that the words tab is showing. Practice the CVC words in isolation (picture support included). Then practice the sight words with the flashcards provided. Finally, "focus" on reading the text and answer the compre
Preview of Beginning Sounds Picture Cards for Preschool and Kindergarten

Beginning Sounds Picture Cards for Preschool and Kindergarten

Created by
Annie Jewell
These beginning sounds picture cards have pictures for all 26 letters from A to Z. There are 438 picture cards perfect for introducing letters and beginning sounds, sorting by beginning sounds, building vocabulary, and sorting by number of syllables.Included are 438 picture cards in color and 438 picture cards in blackline. Additionally, there are 26 letter cards in color and blackline in 2 sizes.Picture cards have crisp, colorful clip art that children love! Blackline picture cards are included
Showing 1-24 of 12,633 results

Find Reading resources | TPT

Learn more about reading resources

Not only is reading a core concept in the study of English language arts, but it’s also a cornerstone skill for proficiency in many other subjects (for instance, without strong reading skills, students won’t be able to solve math word problems or read through primary sources for social studies class).

If you’re a teacher or parent looking for printable and digital reading resources to help your student learn a reading concept, look no further! TPT has an extensive collection of resources, created by other teachers, that are designed to help with any need across grade levels.

Elementary students just learning to read can practice the basics with some simple, fun phonics practice activities or small-group reading centers focused around sight words. Students in middle and high school can read novels and complete hands-on, interactive assignments that build their comprehension and critical thinking skills. With plenty of TPT resources at your fingertips, you can sharpen your student's reading skills in no time.

Fun and engaging reading activities to try

Engaging reading activities can energize your students and foster a love of reading. Here are a few ideas for reading activities from our teacher-created resources that you can find on TPT and try in your classroom:

Interactive Phonics Activities

Use hands-on activities such as sorting, matching, or building words with manipulatives to help students recognize phonics patterns and learn word families.

Word Hunts

Encourage students to find specific words either in a text or around the classroom to help reinforce sight word recognition.

Reader's Theater

Bring short stories, books, poems, or plays you’re reading in class to life by assigning roles to students and having them act out scenes. This can help enhance fluency and comprehension.

Interactive Read-Alouds

Engage the class by pausing during read-alouds to discuss the story’s theme, reflect on a character’s motivations or actions, or to ask students questions.

Comparative Analysis

Explore different adaptations of the same story (book versus movie, classic version versus a modern retelling) to encourage analysis of interpretation and presentation. You can also pair texts that are similar in theme, like poems and songs.

By incorporating these (and other!) reading activities into your lesson plans, you can nurture a love for reading while enhancing comprehension, critical thinking, and communication skills.

Frequently asked questions about teaching reading

What types of reading resources are available on TPT?

There are many different types of reading resources sold by Sellers on TPT. Some popular reading lessons include: phonics, vocabulary, spelling, and balanced literacy.

How do I find reading lessons on TPT?

Educators can save time preparing reading lessons with resources created by experienced teachers. Simply start a search for reading resources on the TPT marketplace, and filter by grade level, price, and/or resource type to find materials that've been proven to work in classrooms like yours. No matter what you’re teaching, there are plenty of reading lessons and activities sold by Sellers on TPT that are tailored to meet your students' skill levels.

How can I make my reading lessons fun and engaging?

Students learn best when they're engaged! Sprinkle a little fun into your reading lessons by using manipulatives, pairing unusual texts like poems and short films together, or doing an escape room activity.