101 results
Not grade specific basic principles resources for Microsoft PowerPoint
NGSS Back to School Open House or Curriculum Night Google Slides Editable
If you're looking for the perfect way to explain the Next Generation Science Standards NGSS to parents on Back to School Night, Meet the Teacher, or during Open House or Curriculum Night, then this is the Google Slides/PowerPoint slideshow presentation for you! It is composed of 15 completely EDITABLE slides with a gray themed background and images relevant to the topics discussed. There are links embedded into the slides for smooth and professional transitions between slides! A link is provided
Subjects:
Grades:
Not Grade Specific
Also included in:Â NGSS Middle School Science Activities and Lessons Growing MEGA Bundle
FIRST AID: PRESENTATION
This Presentation includes First Aid Information on:1. Sprain2. Fracture3. No Breathing4. Shortness of Breath5. Heartburn6. Asthma7. Heavy Bleeding8. Epilepsy9. Stroke10. Choking11. Burn12. Heat Stroke13. Heart Attack
Subjects:
Grades:
Not Grade Specific
Also included in:Â HEALTH TIPS FOR HEALTHY LIVING: BUNDLE
Gradual Release of Responsibility Posters
A model for success for all students!The Gradual Release of Responsibility - Instructional Framework, is a teaching process that allows your learner's to work towards independence. It takes students through modelled or demonstrated skills and concepts, before moving onto guided, collaborative and independent processes.Stages of The Gradual Release of Responsibility:I DO - Modelled teachingWE DO - Guided learningYOU DO - Collaborative practiceYOU DO - Independent practiceWhat's Included:2 Poster
Grades:
Not Grade Specific
Unit 1: Structures of Organisms
This lecture includes information on general cells, DNA, DNA replication, protein synthesis, mutations, mitosis, cancer and more! It can be broken up over multiple days to provide the lecture for a whole first unit or multiple smaller units.
Subjects:
Grades:
Not Grade Specific
NGSS:
HS-LS1-1
, HS-LS1-4
Consider the Kings of ISRAEL & JUDAH (as a united kingdom)
These are great visuals to put around the top of your church classroom as you teach them one by one through The Scripture Scout’s SLEUTH FOR THE TRUTH curriculum, but can be used with your own method of teaching the Bible kings of Israel, Judah and a United Kingdom. These pages/slides/cut-outs note whether it was a GOOD king (yellow/gold) or a BAD king (red). Some were a little of both ...THIS DOWNLOAD IS THE KINGS THE UNITED KINGDOM OF ISRAEL & JUDAH.Simple instructions for preparing the UN
Subjects:
Grades:
Not Grade Specific
Science Bundle Changes in Matter PPT, Multiple Choice Questions and Answers PDF
Properties and Changes in Matter Science Powerpoint PPT File59 Slides, PDF File, and Question Multiple Choice Cards. Please take a few seconds to download the free preview to see why this file would benefit your science program.A great visual to teach your students about Matter.This file includes:1) What is matter.2) The Particle Theory - Diagram of the molecules of a solid, liquid, and gas3) Inanimate and animate objects.4) Definitions5) Evaporation, Sublimation, Condensation, Freezing, Melting
Subjects:
Grades:
Not Grade Specific
Scientific Method Steps: Posters or PowerPoint Presentation
This product consists of 18 posters about the Steps in the Scientific Method. They can also be used as an introduction PowerPoint presentation, if preferred.Uploaded as both a PDF and a PPT (fully editable).Included Posters:The ProblemThe ResearchThe Review of LiteratureThe BibliographyThe HypothesisThe MaterialsThe ProceduresControlling VariablesThe ExperimentThe GraphThe Analysis of DataThe ConclusionThe ApplicationThe AbstractThe Final ReportThe DisplayThe Oral PresentationIf you are looking
Subjects:
Grades:
Not Grade Specific
Lab Safety warm up
Half sheet printout for students to complete as they enter the classroom as their warm up. Can also be used as an exit ticket.
Subjects:
Grades:
Not Grade Specific
Types:
FORCE & MOTION Word Search Puzzle Worksheet Activity
Introduce and review physics vocabulary with this super fun force and motion word search worksheet. Word search puzzles make great no prep activities for early finishers, bell ringers, morning work, handouts, homework, lesson plan supplements, sponge activities, introductions to new topics, and sub files.The 34 hidden vocabulary words are:ACCELERATIONACTIONBALANCEDCENTRIPETALDECELERATIONELASTICITYFORCEFRICTIONGRAVITYINERTIAKINETICLAWMASSMOMENTUMMOTIONNEWTON'SPOTENTIALREACTIONSUDANSYRIATENSIONTUN
Subjects:
Grades:
Not Grade Specific
Types:
Also included in:Â Word Search Puzzles BUNDLE Early Finishers Activities Morning Work.
Understanding AM & PM PowerPoint Presentation
Ask most adults what does AM and PM actually mean and most, understandably, do not know. Yet we say, use and structure our lives around the clock, time, and... AM and PM. Your kids will love finding these answers and more about the origin and meaning of AM and PM in a fun historical look back at the origin of AM and PM. 6 pages and/or PowerPoint slide show format available.
Grades:
Not Grade Specific
Woman in Science Project
Are you looking for a way for your students to practice their research skills while learning about women in science? Look no further! This project consists of two parts, a one-page narrative on a woman in science along with a presentation rubric for students to follow along with. I use the "Women in Science" book by Rachel Ignotofsky for my students to look through and choose a scientist from, but students could choose a woman scientist of their own as well. RUBRICS INCLUDED.
Grades:
Not Grade Specific
Univariate Stats: Frequency Distribution Table, Animated PPT w/ Scaffolded Notes
This Univariate Stats: Frequency Distribution Table resource contains scaffolded note pages that correspond to an interactive PowerPoint for your scientific method or statistics unit. There is a Tip & Tricks slide and corresponding note page that compiles feedback, notes, and helpful information I have personally seen benefit my students.Please be aware that this lesson was designed for a criminal justice-based statistics course; as such, topics and applied word problems use related themes.P
Subjects:
Grades:
Not Grade Specific
CCSS:
NGSS:
HS-LS4-3
Constants, Variables, & Level of Measurement Animated PPT w/ Scaffolded Notes
This constants, variables, and level of measurement resource contains an interactive and animated PowerPoint with matching scaffolded style notes for your scientific method or statistics unit. There is a Tip & Tricks slide and corresponding note page that compiles feedback, notes, and helpful information I have personally seen benefit my students.Please be aware that this lesson was designed for a criminal justice-based statistics course; as such, topics and applied word problems use related
Subjects:
Grades:
Not Grade Specific
CCSS:
NGSS:
HS-LS3-3
Univariate Stats: Frequency Distribution Table, Animated PPW & Knowledge Checks
This Univariate Statistics: Frequency Distribution Table resource contains an interactive and animated PowerPoint for your scientific method or statistics unit. You can also purchase the matching scaffolded notes. There is a Tip & Tricks slide and corresponding note page that compiles feedback, notes, and helpful information I have personally seen benefit my students.Please be aware that this lesson was designed for a criminal justice-based statistics course; as such, topics and applied word
Subjects:
Grades:
Not Grade Specific
CCSS:
NGSS:
MS-LS4-6
Life Science Packet - 6 topics worksheets, organizers, & MC plus 30Q exam
Christmas / Winter Break Packet!This 25 page packet includes 1 written activity for each of the topics listed below along with 27 multiple choice test questions. When done, the students will have a completed graphic organizer and a handful of practice MC questions for each topic. A blank glossary and answer sheet is included for the teacher to collect and grade if used as an assessment. Finally, there is a 30 question exam made up of multiple choice standardized test questions. This activit
Subjects:
Grades:
Not Grade Specific
Types:
NGSS:
HS-LS1-5
, MS-LS1-2
, MS-LS2-2
, MS-LS1-3
, HS-LS1-2
 ...
Crazy Adaptations PowerPoint/Slideshow
Plant and animal adaptations are one of my favorite topics to teach! I especially love showing students the crazier adaptations! So I created a PowerPoint with some of the coolest adaptations I've found!
This slideshow includes a slide for each of the following organisms. *Each slide has a box explaining the different adaptations of the organism and other facts about it!
-Baobab Trees
-Mangrove Trees
-Pitcher Plants
-Sundew Plant
-Venus Flytrap
-Southern Flannel Caterpillar
-Spiny Orb Weaver
Subjects:
Grades:
Not Grade Specific
Constants, Variables, & Level of Measurement Animated PPW, Knowledge Checks
This constants, variables, and level of measurement resource contains an interactive and animated PowerPoint for your scientific method or statistics unit. You can also purchase the matching scaffolded notes. There is a Tip & Tricks slide and corresponding note page that compiles feedback, notes, and helpful information I have personally seen benefit my students.Please be aware that this lesson was designed for a criminal justice-based statistics course; as such, topics and applied word prob
Subjects:
Grades:
Not Grade Specific
CCSS:
NGSS:
HS-LS3-3
Independent Variables, Dependent Variables, & Contingency Tables, Animated PPW
This Independent Variables, Dependent Variables, & Contingency Tables resource contains an interactive and animated PowerPoint for your scientific method or statistics unit. You can also purchase the matching scaffolded notes. There is a Tip & Tricks slide and corresponding note page that compiles feedback, notes, and helpful information I have personally seen benefit my students.Please be aware that this lesson was designed for a criminal justice-based statistics course; as such, topics
Subjects:
Grades:
Not Grade Specific
CCSS:
NGSS:
MS-PS3-4
, 5-PS1-3
, 5-PS1-4
, HS-PS3-4
, HS-PS2-5
 ...
G 9 Birth, life and death of a star in PowerPoint
Life cycle of a star, gases clumps, swirling, nuclear fusion, time frames, nebula, birth of a star, life of a star, details about the sun, death of a star, neutron star, black hole, gravitational pull & many videos. Excellent for classroom teaching with a data projector & for use on a mobile.
Subjects:
Grades:
8th - 10th, Not Grade Specific
Also included in:Â Grade 9 Earth and beyond in animated PowerPoint.
Matter PPT
Teach all about the three states of matter by using this informational PPT. It is filled with hands-on learning activities and video links where students are SURE to grasp the concept of the states of matter!
Subjects:
Grades:
Not Grade Specific
60 x Starter Wordsearches Science Chemistry Physics Biology Wordsearch
60 x starter-style wordsearches covering 60 themes including:
1. Living Organisms
2. Nutrition, Digestion & Excretion
3. Respiration
4. Transport in Plants
5. Nerves & Hormones
6. Health & Disease
7. Reproduction
8. Inheritance & Genetics
9. Ecosystems & Habitats
10. Evolution
11. Solids, Liquids & Gases
12. Atomic Structure
13. Quantitative Chemistry
14. Metals
15. Organic Chemistry
16. Acids, Alkalis & Salts
17. Energy
18. Crude Oil & Fuels,
19. Chemical Indust
Subjects:
Grades:
Not Grade Specific
Binary Code Bundle
Binary Code Bundle includes the conversion of numbers 1 to 10 in binary code. Worksheets are provided for students to practice writing in binary code. The bundle includes music and lyrics to a binary code song. Own it today in Shawnessy's Thoughts.
Subjects:
Grades:
Not Grade Specific
Types:
Simple Machines (PowerPoint)
Have fun and incorporate technology into your lessons by downloading this PowerPoint lesson on simple machines. *Lesson includes numerous thought provoking review questions and as well as a fun pop quiz to get student's thinking. ----------------------------------------------------------------------------------------------------------------*POWERPOINT INCLUDES:Vocabulary WordsWhat is a Machine?Simple MachinesInclined PlaneWedgeScrewLever (First-Class Lever, Second-Class Lever, Third-Class Lever)
Subjects:
Grades:
Not Grade Specific
Science Tools and Science Inquiry Skills Centers
This product contains two of my products together at discounted price:
Science Inquiry Skills Centers
Students can practice the following science inquiry skills: infer, classify, sequence, and compare. Each one of the centers provides an activity for the children to complete, as well as a question for them to answer in their science notebook. Furthermore, the students also have an extension activity at each station. the centers provide visuals and scaffolded support so that all children can pa
Grades:
Not Grade Specific
Types:
Showing 1-24 of 101 results
TPT is the largest marketplace for PreK-12 resources, powered by a community of educators.
IXL family of brands